PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Do016076.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Dichantheliinae; Dichanthelium
Family bZIP
Protein Properties Length: 213aa    MW: 22510.4 Da    PI: 9.887
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Do016076.1genomeDichanView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_149.68.9e-16142192353
                 XXCHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
      bZIP_1   3 elkrerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelk 53 
                 +++r +r++kNRe+A rsR+RK+a++ eLe++v+ L++e k+L+ + e+l+
  Do016076.1 142 SDRRKKRMIKNRESAARSRARKQAYVRELEREVQLLQEEIKSLRVKYEQLR 192
                 689*****************************************9999986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003382.3E-10140207IPR004827Basic-leucine zipper domain
PROSITE profilePS5021711.461142192IPR004827Basic-leucine zipper domain
PfamPF001701.2E-13143192IPR004827Basic-leucine zipper domain
Gene3DG3DSA:1.20.5.1703.5E-13144193No hitNo description
CDDcd147077.63E-19144191No hitNo description
SuperFamilySSF579598.75E-12144192No hitNo description
PROSITE patternPS000360147162IPR004827Basic-leucine zipper domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009911Biological Processpositive regulation of flower development
GO:0010200Biological Processresponse to chitin
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:2000028Biological Processregulation of photoperiodism, flowering
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
GO:0043621Molecular Functionprotein self-association
Sequence ? help Back to Top
Protein Sequence    Length: 213 aa     Download sequence    Send to blast
MDMEDDEDIW ANTASSPSAS PPRPLAAAAA VSPCGAFIST QLSLNSRLHL LSSAAAAGGG  60
TSRPRPAVAG AGAGIYAADA VRHHMGLGGG FRNAAASPAP YFSYNLDDDA GVGAARSMLE  120
DEMYLGPGAA AATWASAGVG GSDRRKKRMI KNRESAARSR ARKQAYVREL EREVQLLQEE  180
IKSLRVKYEQ LRVSAEVPVP VRKTLQRMPS APF
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankLC0201164e-60LC020116.1 Sasa veitchii var. hirsuta SvFDL2 mRNA for FD-like gene, complete cds, strain: SvFLD2c.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004957504.13e-98PREDICTED: ABSCISIC ACID-INSENSITIVE 5-like protein 5
TrEMBLK3ZWU53e-98K3ZWU5_SETIT; Uncharacterized protein
STRINGSi031077m9e-98(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP97643044
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G17770.23e-15basic region/leucine zipper motif 27